PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g025180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family SRS
Protein Properties Length: 371aa    MW: 38308.1 Da    PI: 7.5238
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g025180.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.82.4e-711382853153
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaesk 97 
                     +g++sCqdCGnqakkdCah+RCRtCCksrgf+C thv+stWvpaakrrerqqqla+ + +++  + e+ +kr+re+  +++s+l +t+++s+   
  Csa06g025180.1 138 NGGVSCQDCGNQAKKDCAHMRCRTCCKSRGFECPTHVRSTWVPAAKRRERQQQLATVQPQTQLPRGESVPKRHRENFPATSSSLVCTRIPSQ--- 229
                     6889*****************************************************99999999***********************9987... PP

          DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                     + le+ ++P+evss+avfrcvrvssv+dgeee+aYqtavsigGh+fkGiLyd+G+ 
  Csa06g025180.1 230 SGLEVGNFPAEVSSPAVFRCVRVSSVEDGEEEFAYQTAVSIGGHIFKGILYDHGPG 285
                     47899*************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.4E-65140284IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.0E-27142184IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.6E-27237284IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MAGFFSLDGG GGGGGGNNQE DHRSNTNPPP PVSEAWLWYR NPNANANANA NANAPSSSNG  60
AALGTLELWQ NHNQQEIMFQ HQQQHQQRLD LYSSAAGLGV GPSNHSQFDI SGETSTAGAG  120
RAAGLMMIRS GGGGGGGNGG VSCQDCGNQA KKDCAHMRCR TCCKSRGFEC PTHVRSTWVP  180
AAKRRERQQQ LATVQPQTQL PRGESVPKRH RENFPATSSS LVCTRIPSQS GLEVGNFPAE  240
VSSPAVFRCV RVSSVEDGEE EFAYQTAVSI GGHIFKGILY DHGPGSSGGG GYNVVAAGES  300
SSGGGGGQQL NLITAGSVTV ATASSSTPNL GGGIGSTSAA AVTYIDPAAL YPTPINTFMA  360
GTQFFPHPRS *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0295090.0BT029509.1 Arabidopsis thaliana At3g51060 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010515488.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9SD400.0SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLR0HK220.0R0HK22_9BRAS; Uncharacterized protein
STRINGAT3G51060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-169Lateral root primordium (LRP) protein-related